PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07154A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 318aa    MW: 34029.8 Da    PI: 8.6164
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07154AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-154791147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r rW++eE+ +++da  ++G + Wk+I +++   +t+ q++s+ qky
  Oropetium_20150105_07154A 47 RERWSAEEHGRFLDALLMFGRD-WKKIEEHVR-SKTAVQIRSHAQKY 91
                               78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.83E-174197IPR009057Homeodomain-like
PROSITE profilePS5129417.4484296IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-74498IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-164594IPR006447Myb domain, plants
SMARTSM007171.4E-94694IPR001005SANT/Myb domain
PfamPF002496.9E-124791IPR001005SANT/Myb domain
CDDcd001671.64E-74992No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MACYISASAF GDGGISAPTR LTMDDRGGSS EMPGKKARKP YTITKPRERW SAEEHGRFLD  60
ALLMFGRDWK KIEEHVRSKT AVQIRSHAQK YFIKVQKLGL AAGLPPQYPR RRLVMQQQPG  120
SPAGVSAAET PLLQGSQPHG APVGMPPGPS DGVAHGSSIG WDCPGILPAA AVTGKCLFLQ  180
SLGWTVPSGP SAWVGSSLIG APSFSNATME LAGSSSSSEP AAATGNNAQD EIIQLPLSPD  240
DLHFAQVYRF VGDMFDPNTA CPVEAHLRKL TDMDDITVKT ILLVLRNLET NLSAPQFEPV  300
RRLLSRYDPT RGLSGQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971681.11e-125PREDICTED: protein REVEILLE 8-like isoform X2
TrEMBLI1NKD31e-128I1NKD3_ORYGL; Uncharacterized protein
STRINGORGLA01G0032300.11e-127(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-50MYB_related family protein